Tesamorelin 5mg

In stock
Lot: 74659
Grade: Laboratory
Purity: >99%
Vial Size: 3ml
Tested For: Purity, Sterility, & Endotoxins
Made in a cGMP/ISO Compliant U.S. Facility
UPS Shipping: Insurance Included
Arrives Lyophilized: Requires Reconstitution
Regular price $44.99 USD

Research Use Only

This product is limited to in vitro testing and laboratory experimentation only and is not for human or animal use or consumption of any kind. Handling and use are restricted to qualified and licensed professionals only. Bacteriostatic water not included and sold separately. We are unable to provide guidance on dosages or reconstitution.

Compound: Tesamorelin 5mg

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Vial Size: 3ml

  • Store at -20°C (freezer) for long-term stability.
  • Keep away from light, moisture, and heat.
  • Once reconstitued store at 2-8°C (refrigerator).
  • Discard any solution that becomes discolored or shows signs of contamination.

This product is supplied as a lyophilized powder and is intended strictly for research use only. Researchers are solely responsible for the appropriate reconstitution of all OROS research compounds. Bacteriostatic water is sold separately. We do not sell syringes, nor do we provide instructions on mixing, dosing, or any research protocols.

This product is limited to in vitro testing and laboratory experimentation and is not intended for human or animal use or consumption under any circumstances. Handling and use are restricted to qualified and licensed professionals only.

This product is not classified as a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled as such.

All orders placed through OROS Research are shipped via UPS (free 2-day shipping on orders over $125), and includes full insurance in the event your package is lost, stolen, or damaged in transit.

Once your order is handed off to UPS, delivery times are no longer within our control. While most shipments arrive within 2–3 business days, delays may occur due to weather conditions, holidays, high-volume periods, or weekend inactivity, during which packages are not in transit.

To help ensure product integrity during transit, all research materials are packaged in protective boxes that shield vials from direct sunlight and temperature fluctuations. Additionally, our lyophilized (freeze-dried) research peptides are highly stable and can withstand elevated temperatures for extended periods without compromising quality or efficacy.

Rated Excellent on Trustpilot
Read our reviews

Rigorously-Tested. Backed by Third-Party COAs

Every batch is independently tested by DEA-licensed labs based in the United States. Using advanced analytical techniques like High-Performance Liquid Chromatography (HPLC), we verify each compound’s identity, purity (≥99%), net-content, sterility, and endotoxin levels. These rigorous testing protocols ensure that every product we offer meets the highest standards of quality, consistency, and research safety. All results are documented through verifiable, third-party Certificates of Analysis (COAs).

Identity Test

Passed

Confirms the compound is correctly labeled and matches official reference standards.

Purity Test

Passed

Ensures the compound is present at ≥99% purity for consistent and reliable results.

Sterility Test

Passed

Verifies the absence of bacteria, fungi, or microbial contamination.

Endotoxin Test

Passed

Detects and quantifies endotoxins (LPS) to ensure the product is free from harmful bacterial byproducts.

Verify Test Results

Want to confirm our testing results? Click below and type OROS in the search bar to view all available lab reports — or use the unique accession code found on your COA to locate your specific batch.

Verify COA

Science Without Shortcuts™

Founded in 2025, OROS Research was created with a singular mission: to bring integrity, transparency, and uncompromising quality to the research peptide industry. Born out of frustration with a market saturated by corner-cutting and profit-first mindsets, we set out to redefine what researchers should expect and deserve.

At OROS, we manufacture our peptides in California in an ISO 5 Laminar Flow Facility following cGMP standards, ensuring every product meets the highest standards of purity, and precision. We don’t just claim quality, we prove it through rigorous testing and verifiable third-party COAs provided by licensed testing facilities in the U.S.

Built by researchers, for researchers, we believe in doing things the right way. No shortcuts, no gray areas, and no false promises. Just high-purity, genuine USA-made peptides, reliable service, and a relentless focus on helping our research customers achieve meaningful results.

Learn More

Frequently Asked Questions

Answers to our most common questions.

What is this product for?

This compound is intended strictly for in-vitro research use only. It is not for human or animal consumption, cosmetic use, or diagnostic purposes.

Are your products tested?

Yes. Every batch is third-party tested by a DEA-licensed U.S. laboratory for identity, purity, net content, and the absence of endotoxins. Only batches meeting strict specifications are released for research use.

What are endotoxins, and why test for them?

Endotoxins are bacterial fragments that can interfere with research outcomes, even at extremely low concentrations. OROS is one of the few U.S.-based suppliers that tests every batch for endotoxins to ensure consistency and reliability in your research.

Where can I find the Certificate of Analysis (COA)?

COA reports are available on each product page within the product image gallery. All current and previous batch information—including lot numbers, manufacturing dates, expiration dates, and testing—can be found on our Lab Results Page.

Is this product made in the USA?

Yes. All compounds are formulated and lyophilized in California at a trusted cGMP-compliant partner facility. RAW materials are sourced from both domestic and overseas suppliers who meet strict GMP, ISO 9001:2015, and ISO/IEC 17025 quality standards. All testing is performed in the United States by a DEA-licensed laboratory.

Why do you not source your raw materials exclusively from the USA?

The majority of active pharmaceutical ingredients (APIs) used worldwide, including those used by U.S. pharmaceutical manufacturers and compounding facilities, are produced overseas. Our manufacturing partner sources domestically when possible; however, it is not feasible to source 100% of raw materials exclusively from the United States. This is standard practice across both the research peptide sector and the pharmaceutical industry.


What matters most is that all formulation, lyophilization, and third-party testing occur entirely in the United States, ensuring strict quality control and batch-level verification.

How is it shipped?

All orders are shipped from our North Carolina warehouse via UPS, with your choice of Ground, 2-Day, or Express services. Orders over $125 receive free UPS 2-Day shipping. Every order includes full shipment insurance at no additional cost.

Where do you ship?

We currently ship to U.S. addresses only. We do not ship to PO Boxes, international destinations, military bases, or U.S. territories.

What payment methods do you accept?

We accept all major debit and credit cards, including American Express. HSAs and FSAs are not accepted.

After checkout, you must complete our secure Payment Authorization Form. Orders are not processed or shipped until authorization is completed. This workflow ensures PCI compliance and protects your payment data.

Do you accept returns?

All sales are final. If an issue occurs with your order, please contact support@orosresearch.com within 7 days of delivery.

How should this product be stored?

Before reconstitution, store lyophilized peptides in a cool, dry environment away from light. Once reconstituted, research compounds should be refrigerated for optimal stability.

Looking for more answers?

Visit our Full FAQ Page for detailed information on storage, COAs, policies, and additional support.