Tesamorelin 5mg

Out of stock
SKU: PT-TESAMO-5
Grade: Laboratory
Purity: >99%
Vial Size: 3ml
Manufactured in a U.S. Lab Certified for GMP | ISO 9001:2015 Compliance
UPS Ground Shipping: Thermal Mailer
Arrives Lyophilized: Requires Reconstitution
Regular price $54.99 USD

Research Use Only

This product is limited to in vitro testing and laboratory experimentation and is not for human or animal use or consumption of any kind. Handling and use are restricted to qualified and licensed professionals only.

Compound: Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Vial Size: 3ml

  • Store at -20°C (freezer) for long-term stability.
  • Keep away from light, moisture, and heat.
  • Once reconstitued store at 2-8°C (refrigerator).
  • Discard any solution that becomes discolored or shows signs of contamination.

This product is supplied as a lyophilized powder and is intended strictly for research use only. Researchers are solely responsible for the appropriate reconstitution of all OROS research compounds. Bacteriostatic water is sold separately. We do not sell syringes, nor do we provide instructions on mixing, dosing, or any research protocols.

This product is limited to in vitro testing and laboratory experimentation and is not intended for human or animal use or consumption under any circumstances. Handling and use are restricted to qualified and licensed professionals only.

This product is not classified as a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled as such.

Rigorously-Tested. Backed by Third-Party COAs

Every batch is independently tested by DEA-licensed labs based in the United States. Using advanced analytical techniques like High-Performance Liquid Chromatography (HPLC), we verify each compound’s identity, purity (≥99%), sterility, and endotoxin levels. These rigorous testing protocols ensure that every product we offer meets the highest standards of quality, consistency, and research safety. All results are documented through scannable, third-party Certificates of Analysis (COAs).

Identity Test

Passed

Confirms the compound is correctly labeled and matches official reference standards.

Purity Test

Passed

Ensures the compound is present at ≥99% purity for consistent and reliable results.

Sterility Test

Passed

Verifies the absence of bacteria, fungi, or microbial contamination.

Endotoxin Test

Passed

Detects and quantifies endotoxins (LPS) to ensure the product is free from harmful bacterial byproducts.

Science Without Shortcuts

Founded in 2025, OROS Research was created with a singular mission: to bring integrity, transparency, and uncompromising quality back to the research peptide industry. Born out of frustration with a market saturated by corner-cutting and profit-first mindsets, we set out to redefine what researchers should expect — and deserve.

At OROS, we exclusively source and manufacture our peptides in the United States in GMP-licensed laboratories, ensuring every product meets the highest standards of purity and precision. We don’t just claim quality — we prove it through verifiable third-party COAs provided by licensed U.S. labs.

Built by researchers, for researchers, we believe in doing things the right way — no shortcuts, no gray areas, and no false promises. Just high-purity peptides, trusted service, and a relentless focus on helping our research customers achieve meaningful result.

Learn More

Frequently Asked Questions

Answers to our most common questions.

What is this product for?

This compound is intended for research use only. It is not for human consumption, cosmetic, or diagnostic purposes.

How is it shipped?

All vials are shipped in padded thermal mailers via UPS Ground. We charge a flat $15 fee that includes tracking and full insurance.

Is it tested?

Yes. Every batch is third-party tested by a DEA-licensed laboratory based in the United States. Each product includes a downloadable Certificate of Analysis (COA) that verifies purity, identity, and compliance for research use.

Where do you ship?

We currently ship within the U.S. only. No shipments to military bases, international addresses, or U.S. territories.

Do you accept returns?

All sales are final. If there’s an issue with your order, please contact support@orosresearch.com within 7 days.

Is this product made in the USA?

Yes. All of our research compounds are made in the USA and sourced from GMP-compliant and ISO 9001:2015-certified manufacturers to ensure exceptional quality, safety, and reliability.

Looking for more answers?

Visit our Full FAQ Page for detailed information on policies, storage, COAs, and more.