Tesamorelin 5mg

In stock
Lot: OR-LPTES5-626-B7
Grade: Laboratory
Purity: >99%
Vial Size: 3ml
Tested: Purity, Identity, Net Content, Multi-Vial, Endotoxins, Heavy Metals, Microbials, Residual Solvents
U.S. Formulated: cGMP / ISO Aligned
UPS Shipping: Insurance Included
Arrives Lyophilized: Requires Reconstitution
Regular price $44.99 USD
In stock
Ships Within 1 Business Day

Research Use Only

This product is limited to in vitro testing and laboratory experimentation only and is not for human or animal use or consumption of any kind. Handling and use are restricted to qualified or licensed professionals only, at least 21 years of age. Reconstitution Solution not included and sold separately. We are unable to provide guidance regarding research use or reconstitution.

Compound: Tesamorelin 5mg

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Vial Size: 3ml

  • Store at -20°C (freezer) for long-term stability.
  • Keep away from light, moisture, and heat.
  • Once reconstitued store at 2-8°C (refrigerator).
  • Discard any solution that becomes discolored or shows signs of contamination.

This product is supplied as a lyophilized powder and is intended strictly for research use only. Researchers are solely responsible for the appropriate reconstitution of all OROS research compounds. Reconstitution Solution is sold separately. We do not sell syringes, nor do we provide instructions on mixing, dosing, or any research protocols.

This product is limited to in vitro testing and laboratory experimentation and is not intended for human or animal use or consumption under any circumstances. Handling and use are restricted to qualified or licensed professionals only.

This product is not FDA approved and is not classified as a drug, food, or cosmetic. It may not be represented, marketed, or used as such

All orders placed through OROS Research are shipped via UPS (free 2-day shipping on orders over $150), and includes full insurance in the event your package is lost, stolen, or damaged in transit.

Once your order is handed off to UPS, delivery times are no longer within our control. While most shipments arrive within 2–5 business days, delays may occur due to weather conditions, holidays, high-volume periods, or weekend inactivity, during which packages are not in transit.

To help ensure product integrity during transit, all research materials are packaged in protective boxes that shield vials from direct sunlight and temperature fluctuations. Additionally, our lyophilized (freeze-dried) research peptides are highly stable and can withstand elevated temperatures for extended periods of time without compromising quality or efficacy. Because of this, we do not ship with cold packs.

Rated Excellent on Trustpilot
Read our reviews

NAD+ Buffered 500mg - OROS Research

Science Without Shortcuts™

Founded in 2025, OROS Research was created with a singular mission: to bring integrity, transparency, and uncompromising quality to the research peptide industry. Born out of frustration with a market saturated by corner-cutting and profit-first mindsets, we set out to redefine what researchers should expect and deserve.

At OROS, we formulate and finish our peptides in California in an ISO 5 Laminar Flow Facility following cGMP standards, ensuring every product meets the highest standards of purity, and precision. We don’t just claim quality, we prove it through rigorous testing and verifiable third-party COAs provided by licensed testing facilities in the U.S.

Built by researchers, for researchers, we believe in doing things the right way. No shortcuts, no gray areas, and no false promises. Just high-purity, genuine USA-formulated peptides, reliable service, and a relentless focus on helping our research customers achieve meaningful results.

Learn More

Frequently Asked Questions

Answers to our most common questions.

What is this product for?

This product is intended strictly for in-vitro laboratory research use only. It is not intended for human or animal consumption, medical use, cosmetic use, diagnostic use, therapeutic use, compounding, or resale as a finished drug product.

OROS Research products are not drugs, medications, dietary supplements, food products, cosmetics, or medical devices.

Are your products tested?

Yes. Every newly released OROS lyophilized batch undergoes independent third-party testing prior to release. As of April 2026, all new OROS lyophilized product batches are tested through independent ISO-accredited laboratories.

Depending on the product type, testing may include identity confirmation, chromatographic purity by HPLC, net content verification, endotoxins, heavy metals, microbial contamination, residual solvents, and multi-vial conformity testing.

We believe quality is best evaluated through multiple analytical tests rather than relying on purity alone. This broader approach helps support batch consistency, transparency, and overall product quality.

Who performs your testing?

As of April 2026, all new OROS lyophilized product batches are tested by independent ISO/IEC 17025-accredited laboratories in the United States.

ISO/IEC 17025 is an internationally recognized quality standard for testing laboratories and supports analytical accuracy, reproducibility, traceability, and validated testing methods.

Testing is performed independently from manufacturing operations to provide objective analytical results and an additional layer of transparency.

Why do your COAs show “>99%” purity instead of decimal values?

Our testing partner, Ethos Analytics, reports purity as “>99% Chromatographic Purity by HPLC” rather than emphasizing small decimal differences such as 99.23% versus 99.56%.

At these levels, minor decimal differences may reflect normal analytical variation, sample preparation, instrument response, integration settings, or testing conditions rather than a meaningful difference in product quality.

From a scientific standpoint, the more important questions are whether identity was confirmed, whether the batch meets chromatographic purity specifications, and whether the vial contains the labeled amount of peptide.

We believe this approach helps prevent researchers from overinterpreting insignificant purity differences that may not meaningfully impact product quality.

What does chromatographic purity actually mean?

The purity values reported on our COAs represent chromatographic purity by HPLC. This measures the percentage of the target peptide peak relative to other detectable peaks under specific analytical conditions.

Chromatographic purity does not mean that 99% of the total powder mass in the vial is peptide. Lyophilized products may contain stabilizers, bulking agents, salts, buffers, residual moisture, counterions, and other formulation-related components that support manufacturing, stability, and lyophilization performance.

This is why we identify the result as chromatographic purity by HPLC rather than simply listing “purity.” We believe researchers should understand exactly what is being measured and how that result should be interpreted.

Is purity the most important test?

Purity is an important quality indicator, but it is only one part of the overall quality picture.

A highly pure peptide still needs to have its identity confirmed, its labeled peptide content verified, and its batch screened for contaminants such as endotoxins, heavy metals, microbial contamination, and residual solvents.

OROS Research places significant emphasis on both purity testing and quantitative content verification because confirming that a vial contains the labeled amount of peptide is critical to overall batch quality and transparency.

Why does OROS Research perform testing beyond purity?

Purity testing is an important component of quality verification, but purity alone does not provide a complete picture of overall batch quality. A material may achieve a high purity result while still containing contaminants, inconsistencies, or other quality concerns that are not identified through purity testing alone.

For this reason, OROS Research utilizes a comprehensive testing program designed to evaluate multiple quality attributes beyond identity and purity. Depending on the product type, testing may include net content verification, multi-vial conformity testing, endotoxin screening, heavy metal analysis, microbial testing, and residual solvent analysis.

Endotoxin testing screens for bacterial byproducts that may interfere with certain laboratory applications and research outcomes. Heavy metal testing evaluates trace elemental contaminants that may be introduced through raw materials, manufacturing equipment, water sources, or the production environment.

Microbial testing screens for microorganisms that may be introduced during manufacturing, handling, packaging, or storage. Residual solvent analysis evaluates solvents that may remain from manufacturing, purification, or processing.

Together, these tests provide a more complete assessment of batch quality, consistency, and manufacturing control. OROS Research believes researchers deserve access to meaningful quality data, which is why batch-specific Certificates of Analysis are made publicly accessible whenever available.

Where can I find the Certificate of Analysis (COA)?

COA reports are available on each product page within the product image gallery. Current and previous batch information, including lot numbers, manufacturing dates, expiration dates, and testing documentation, can also be found on our Lab Results Page.

We make COAs accessible so researchers can review relevant batch information before purchasing whenever documentation is available.

Is this product made in the USA?

Yes. OROS lyophilized products are formulated, sterile filled, lyophilized, vialed, and packaged in California at a qualified third-party manufacturing facility operating under controlled processes aligned with cGMP principles.

Raw materials may be sourced from domestic and international suppliers that adhere to established quality standards, including GMP-aligned systems and ISO-based frameworks. Finished products undergo domestic formulation, lyophilization, quality review, and independent third-party testing in the United States.

Why do you not source your raw materials exclusively from the USA?

The majority of active pharmaceutical ingredients and specialty research materials used worldwide, including those used by many U.S. pharmaceutical manufacturers and compounding facilities, are produced overseas. Our manufacturing partner sources domestically when possible; however, it is not always feasible to source 100% of raw materials exclusively from the United States.

What matters most is supplier qualification, manufacturing controls, domestic formulation and lyophilization, and independent third-party testing. Finished OROS batches undergo analytical verification prior to release to support quality, consistency, and transparency.

How is it shipped?

All orders are shipped from North Carolina via UPS, with Ground, 2-Day, and Express delivery options available at checkout. Orders over $150 qualify for complimentary UPS 2-Day Shipping.

Every order includes complimentary full-value shipment insurance. In the event of loss, damage, or theft during transit, our team will work with the carrier to initiate the claims process and help facilitate a resolution as quickly as possible.

Do you ship with cold packs or temperature control?

No. We do not ship lyophilized products with cold packs or cold-chain carrier services. Lyophilized compounds are manufactured to remain stable in a dry, sealed state during normal shipping conditions.

Cold packs can introduce unnecessary condensation, moisture exposure, and temperature cycling inside the package during transit. For lyophilized research materials, protective packaging and prompt carrier delivery are typically preferred over unnecessary cold packing.

Short-term exposure to elevated temperatures during standard transit windows does not necessarily indicate product degradation. Degradation risk is more closely associated with sustained exposure to high heat, humidity, or improper long-term storage.

Where do you ship?

We currently ship to U.S. addresses only. We do not ship to PO Boxes, international destinations, military bases, U.S. territories, or freight forwarding services at this time.

What payment methods do you accept?

We accept all major debit and credit cards. Gift cards, international cards, HSAs, FSAs, and insurance are not accepted.

After checkout, customers must complete our secure Payment Authorization Form. Orders are not processed or shipped until authorization is completed and payment has been reviewed.

This workflow is designed to support secure payment handling and protect customer payment information. OROS Research does not store customer card information on file for future use.

Do you accept returns?

Due to the sensitive nature of our products, all sales are final. We do not accept returns or exchanges once an order has been fulfilled.

If an issue occurs with your order, please contact support@orosresearch.com within 7 days of delivery so our team can review the situation and determine the appropriate next steps.

How should this product be stored?

Before reconstitution, lyophilized products should be stored in a cool, dry environment away from direct light, heat, and humidity. For longer-term storage, freezer conditions are generally preferred for many lyophilized research materials.

Once reconstituted, materials should be handled and stored according to your laboratory’s internal research protocols, study design, and established handling procedures.

Looking for more answers?

Visit our Full FAQ Page for additional information on ordering, account access, shipping, storage, COAs, returns, and product support.