Tesamorelin 16mg, Ipamorelin 4mg (20mg Blend)

Out of stock
Batch: N/A
Grade: Laboratory
Purity: >99%
Vial Size: 3ml
Tested For: Purity, Sterility, & Endotoxins
Formulated in a GMP/ISO Compliant U.S. Facility
UPS 2-Day Shipping: Insurance Included
Arrives Lyophilized: Requires Reconstitution
Regular price $169.99 USD

Research Use Only

This product is limited to in vitro testing and laboratory experimentation only and is not for human or animal use or consumption of any kind. Handling and use are restricted to qualified and licensed professionals only. Bacteriostatic water not included and sold separately. We are unable to provide guidance on dosages or reconstitution.

Compound: Tesamorelin 5mg

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

----------

Compound: Ipamorelin 5mg

Sequence: H-Aib-His-D-2Nal-D-Phe-Lys-NH2

Molecular Formula: C38H49N9O5

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

----------

Vial Size: 3ml

  • Store at -20°C (freezer) for long-term stability.
  • Keep away from light, moisture, and heat.
  • Once reconstitued store at 2-8°C (refrigerator).
  • Discard any solution that becomes discolored or shows signs of contamination.

This product is supplied as a lyophilized powder and is intended strictly for research use only. Researchers are solely responsible for the appropriate reconstitution of all OROS research compounds. Bacteriostatic water is sold separately. We do not sell syringes, nor do we provide instructions on mixing, dosing, or any research protocols.

This product is limited to in vitro testing and laboratory experimentation and is not intended for human or animal use or consumption under any circumstances. Handling and use are restricted to qualified and licensed professionals only.

This product is not classified as a drug, food, or cosmetic and must not be misbranded, misused, or mislabeled as such.

All orders placed through OROS Research are shipped via UPS 2-Day service for a flat rate of $15 (free shipping on orders over $125), which includes full insurance in the event your package is lost, stolen, or damaged in transit.

Once your order is handed off to UPS, delivery times are no longer within our control. While most shipments arrive within 2–3 business days, delays may occur due to weather conditions, holidays, high-volume periods, or weekend inactivity, during which packages are not in transit.

To help ensure product integrity during transit, all research materials are packaged in protective boxes that shield vials from direct sunlight and temperature fluctuations. Additionally, our lyophilized (freeze-dried) research peptides are highly stable and can withstand elevated temperatures for extended periods without compromising quality or efficacy.

Rated Excellent on Trustpilot
Read our reviews

Rigorously-Tested. Backed by Third-Party COAs

Every batch is independently tested by DEA-licensed labs based in the United States. Using advanced analytical techniques like High-Performance Liquid Chromatography (HPLC), we verify each compound’s identity, purity (≥99%), net-content, sterility, and endotoxin levels. These rigorous testing protocols ensure that every product we offer meets the highest standards of quality, consistency, and research safety. All results are documented through verifiable, third-party Certificates of Analysis (COAs).

Identity Test

Passed

Confirms the compound is correctly labeled and matches official reference standards.

Purity Test

Passed

Ensures the compound is present at ≥99% purity for consistent and reliable results.

Sterility Test

Passed

Verifies the absence of bacteria, fungi, or microbial contamination.

Endotoxin Test

Passed

Detects and quantifies endotoxins (LPS) to ensure the product is free from harmful bacterial byproducts.

Verify Test Results

Want to confirm our testing results? Click below and type OROS in the search bar to view all available lab reports — or use the unique accession code found on your COA to locate your specific batch.

Verify COA

Science Without Shortcuts™

Founded in 2025, OROS Research was created with a singular mission: to bring integrity, transparency, and uncompromising quality to the research peptide industry. Born out of frustration with a market saturated by corner-cutting and profit-first mindsets, we set out to redefine what researchers should expect and deserve.

At OROS, we exclusively manufacture our peptides in California in a GMP Compliant Facility, ensuring every product meets the highest standards of purity and precision. We don’t just claim quality, we prove it through verifiable third-party COAs provided by licensed testing facilities in the U.S.

Built by researchers, for researchers, we believe in doing things the right way. No shortcuts, no gray areas, and no false promises. Just high-purity peptides, reliable service, and a relentless focus on helping our research customers achieve meaningful results.

Learn More

Frequently Asked Questions

Answers to our most common questions.

What payment methods do you accept?

We accept all major debit and credit cards, including Visa, Mastercard, American Express, and Discover. We do not accept Health Savings Accounts (HSAs) or Flexible Spending Accounts (FSAs).

Once your order is placed, you will be required to complete our secure and encrypted Payment Authorization Form. Your order will not be processed or shipped until payment is successfully authorized. This process helps us remain compliant with PCI standards while keeping your information safe.

What is this product for?

This compound is intended for research use only. It is not for human consumption, cosmetic, or diagnostic purposes.

How is it shipped?

We ship all orders via UPS 2-Day for a flat fee of $15, which includes full order insurance. UPS Next Day is available at checkout. Orders over $300 qualify for free shipping.

Are your products tested?

Yes. Every batch is third-party tested by a DEA-licensed laboratory based in the United States. Each product includes a Certificate of Analysis (COA) that verifies purity, identity, net content, and absense of endotoxins for research use.

What are endotoxins, and why test for them?

Endotoxins are harmful bacterial fragments that can interfere with research results and trigger unwanted biological responses, even in trace amounts. While many suppliers skip this step, OROS is one of the few U.S.-based companies that tests every batch for endotoxins as part of our quality assurance process. Confirming the absence of endotoxins ensures greater consistency, accuracy, and reliability in your research outcomes.

Where do you ship?

We currently ship within the U.S. only. No shipments to military bases, international addresses, or U.S. territories.

Do you accept returns?

All sales are final. If there’s an issue with your order, please contact support@orosresearch.com within 7 days.

Is this product made in the USA?

Yes. All of our research compounds are formulated in California at a trusted cGMP-compliant partner facility, using raw materials sourced from GMP-compliant, ISO 9001:2015-certified, and ISO/IEC 17025-accredited suppliers. Every batch is tested to ensure identity, purity, and consistency—meeting the highest standards of safety and reliability for research applications.

Looking for more answers?

Visit our Full FAQ Page for detailed information on policies, storage, COAs, and more.